PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G030900.2
Common NameB456_009G030900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB_related
Protein Properties Length: 193aa    MW: 21096.1 Da    PI: 10.3931
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G030900.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.29.1e-14108152347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE+  ++ + ++lG+g+W+ I++ + ++Rt+ q+ s+ qky
  Gorai.009G030900.2 108 PWTEEEHRVFLVGLEKLGKGDWRGISKNFVTTRTPTQVASHAQKY 152
                         8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.532318IPR001878Zinc finger, CCHC-type
Gene3DG3DSA:4.10.60.104.0E-4320IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129419.486101157IPR017930Myb domain
SuperFamilySSF466893.3E-18103157IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-18104156IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.4E-11105151IPR009057Homeodomain-like
SMARTSM007172.1E-10105155IPR001005SANT/Myb domain
PfamPF002491.4E-11108152IPR001005SANT/Myb domain
CDDcd001677.17E-10108153No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MGRKCSHCGN IGHNSRTCTT FRGSSVVGGL RLFGVQLGIS SSSSDSLKKS ISMDCLSSSA  60
SPSSPSPSSS LSSPRISMDE LSDKTTSNIG YLSDGLMAPS HERKKGVPWT EEEHRVFLVG  120
LEKLGKGDWR GISKNFVTTR TPTQVASHAQ KYFLRQSTLN KKKRRSSLFD MVYTIYNYII  180
IISIVMVLQF TS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1160164KKKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6228272e-49JX622827.1 Gossypium hirsutum clone NBRI_GE69725 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012446609.11e-123PREDICTED: transcription factor MYB1R1-like
TrEMBLA0A0D2RT331e-139A0A0D2RT33_G
STRINGVIT_11s0016g02410.t011e-75(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.12e-54MYB_related family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]